PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AL_30B272DDD.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 414aa    MW: 46490.6 Da    PI: 7.0773
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AL_30B272DDD.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21.1e-1494137145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            r +W++eE + l++ ++++G ++W t+a+ ++ gR++ qc+ rw+
  Traes_6AL_30B272DDD.2  94 RVKWSEEENKVLAQMINKHGLKNWQTVAHAIP-GRSAPQCRQRWR 137
                            789*****************************.***********8 PP

2Myb_DNA-binding38.72.3e-12146188145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            + +W+++E+++l++a++ +G++ W+   ++++ gRt   +k++w+
  Traes_6AL_30B272DDD.2 146 KEAWSEQEELRLIRAHQIYGTK-WREMVKHFP-GRTNGAIKEYWR 188
                            579*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.65389140IPR017930Myb domain
SMARTSM007172.3E-1293142IPR001005SANT/Myb domain
SuperFamilySSF466891.03E-2394187IPR009057Homeodomain-like
PfamPF002493.0E-1394137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-1996149IPR009057Homeodomain-like
CDDcd001673.37E-1296137No hitNo description
PROSITE profilePS5129418.2141195IPR017930Myb domain
SMARTSM007173.4E-10145193IPR001005SANT/Myb domain
PfamPF002499.3E-11146188IPR001005SANT/Myb domain
CDDcd001673.00E-9148188No hitNo description
Gene3DG3DSA:1.10.10.605.1E-16150196IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
AHIPNWVGTT GAPFLSYCCS VTCIRLSPSV CTYDYHLYCC WFCWVISIEH NWKDCWFILR  60
FSVTEKGFRG QLCKNDGHSF KESCSITNSE VLTRVKWSEE ENKVLAQMIN KHGLKNWQTV  120
AHAIPGRSAP QCRQRWRYKI DSAINKEAWS EQEELRLIRA HQIYGTKWRE MVKHFPGRTN  180
GAIKEYWRGP MKRKLNSYLS SGLLEQFPDI LENLSGTQNK SLDILKGTKV SDILNDTEGS  240
SERNEMSSAV PRISISEVGF TEVGENADVL GGESADFMYA RVASAKAPEN IIARSEQHAK  300
TRRKLDLLSS PVELKSSSYE VNSQRPLQQR EQMSPAVGGV SPSNGCHDVL PKILSECAKP  360
VLSPTGSYQP SDVHSAGTSD PCSLELDISD LMEMSYFDNL LIFPPGSPHD GNSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23921975110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519050.0JF951905.1 Triticum aestivum clone TaMYB22 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010234128.11e-171PREDICTED: myb-related protein B-like isoform X1
RefseqXP_010234127.11e-171PREDICTED: myb-related protein B-like isoform X1
TrEMBLW5G6400.0W5G640_WHEAT; Uncharacterized protein
STRINGBRADI3G10067.11e-160(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP142631723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.17e-39myb domain protein 3r-4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]